

  • Website Report
  • Server Report
  • Traffic Rank
  • Reach
  • Pageviews
  • Pageviews/User
  • Bounce
  • Time on Site
  • Search

A description has not been provided for this site.

CountryNameUnited States
Alexa traffic rank for myudr.com:
Time RangeTraffic RankChange 
1 month358,82042,060%
3 Months423,144383,804%
Percent of global Internet users who visit myudr.com:
Time RangeReachChange 
1 month0.0004250%
3 Months0.0003160%
Percent of global pageviews on myudr.com:
Time RangePageviewsChange 
1 month0.000006325.97%
3 Months0.0000067130%
Daily pageviews per user for myudr.com:
Time RangePageviews/UserChange 
1 month1.349.04%
3 Months2.040%
The percentage of visits to myudr.com that consist of a single pageview:
Time RangeBounce %Change 
1 month74.44%
3 Months71.65%
Daily time on site for myudr.com:
Time RangeTime on Site(minutes)Change 
The percentage of visits to myudr.com that came from a search engine:
Time RangeSearch %Change 
1 month2.246%
3 Months3.03%
Owner Name: -
Owner Email: -
Adress: -
Owner Phone: -
myudr.com 7.12 out of 10 based on 10 ratings.
Info myudr.com
Alexa Rank: 319,026
Title: UDR Residents - MyUDR - Pay Your Rent, Schedule Maintenance Service, and Renew Your Lease Online.
Description: UDR Resident Services - pay rent online, schedule maintenance, connect utilities, online lease renewal, on-demand concierge, set up Gmail and Yahoo email.
Visits per day: 3,409
Daily Ads Revenue: $11.71
Website Worth: $ 5,270
Creation Date: 2008-04-24
Domain Age: 6years 0days
Domain Expires: 2020-04-24
Server Location: Arizona, United States
Domain Registrar: GODADDY.COM, LLC
Last update:
06-01-2014 12:27:11 (3 months ago)


Sites Like myudr.com ( 38 ):

concierge services nyc | concierge nyc | concierge new york city


about abc nyc concierge.com. russell figaredo welcomes you to experience new yorks best in concierge and personal assistant services with abc nyc concierge.com
family concierge - profesjonalne usugi - warszawa - polska


nasza firma specjalizuje si w usugach typu concierge dla klientw indywidualnych oraz instytucjonalnych
uuu : ultimate luxury, lifestyle & concierge – private and corporate conciergerie


uuu, prcurseur et leader dans l’univers de la conciergerie prive et corporate - uuu, forerunner and leader in personal & corporate concierge services and lifestyle
ꪥ\0\0?df25\0ࡪ\0\0\0?dc65㥷\0df25defa\0 | ץ\0\0 007c printemps ginza online


club concierge - sharing a vision of luxury living...


club concierge is a luxury lifestyle management company, providing indispensable concierge services to residents, organisations and visitors of dubai.
hotel elysee - the first 5 stars hotel in timisoara and banat


the first five stars hotel in timisoara and western romania is a uniquely luxurious construction of classical architecture set in superbly manicured landscaped gardens
concierge training | concierge consultants | triangle concierge, the concierge consultants


leading concierge consulting and training company since 1998. we provide companies of all sizes with customer service consulting and training programs that will take your employees to a whole new lev
charlotte, nc errand petsitting personal shopping house sitting grocery shopping concierge service


need help? let us run your errands! charlotte, nc best errand pet sitting personal shopping house sitting grocery shopping concierge service.
chauffeur hire, prestige chauffeur hire, luxury chauffeur hire, london


luxury chauffeur hire with vennards london. prestige chauffeur hire travel in comfort and style and makes our chauffeur hire stand out from mundane chauffeur hire companies.
modo lifestyle management, concierge services, office services, business support, time management, housekeeper, manchester, cheshire.


modo lifestyle management and concierge services are dedicated to making life easier for our clients - at home and at work. call 01625 423960
iridium 8 - lifestyle management & concierge service


iridium8 is the ultimate accessory for todays modern living, providing lifestyle management for the busy professional. operating in and around the merseyside, cheshire and west lancashire areas, the i
home - le palais hotel - 5-star hotel, prague, czech republic


the luxury 5-star boutique hotel le palais prague is one of the finest examples of belle ㉰oque architecture in prague. the hotel is located in an exclusive residential area of prague, only a 5-minut
toronto events planners :: wedding planning :: corporate events :: martini parties - parris concierge


event planners - corporate events - wedding planning - toronto errand services, parris concierge services.


"gilde" heimbau wohnungsbaugesellschaft mbh
welcome to the san francisco concierge association


organisation that caters for concierge working in and around northern california, usa
concierge services london destination management company concierge service


london concierge services - concierge service in london offering destination management services also - london concierge services tel: 07875 321634
japanaid - interpretation and concierge services for foreigners in japan via the mobile phone - home


japanaid provides interpretation and concierge services for foreigners in japan via the cellular phone. we also rent cellular phones.
wishes concierge ~ personal and professional assistance in barrie & surrounding area


wishes concierge assists those in need of achieving more work/life balance. we aim to give clients back the time to enjoy life and in turn, reduce the stress and pressure of everyday responsibilities.


Bei der Berliner Bau- und Wohnungsgenossenschaft von 1892 eG wohnen Sie sicher und günstig in ganz Berlin. Wir sind eine Genossenschaft mit Tradition und haben eine eigene Spareinrichtung.
Savvydiner.com : The internet\'s dining guide and reservation service


The Internet\'s Premier Dining Reservation Service
Ten Lifestyle


Exclusive offers, restaurant recommendations, entertainment ideas, travel guides and more, from the award-winning Ten Lifestyle Concierge
domystuff.com - outsource your life


at domystuff.com, you can outsource concierge services, chores, tasks and errands to local service providers - saving time and money. its free to join. get reliable help to complete personal chores,
personal assistant and personal concierge services 2006


yours, mine, and hours personal assistant and personal concierge service can make your life easier and more productive. specializing in residential and corporate concierge services, special event and
at your service | paris premier luxury concierge service


at your service is paris’ premier luxury concierge service. we provide the ultimate personal service and dedication to our discriminating clients whether...
fairmount mortuary, denver colorado


welcome to fairmount mortuary, denver co. founded in 1890, we provide mortuary, cremation and burial services. we also provides conceirge, pre-planning and pre-need packages.
legally organized - a full service concierge firm for busy professionals


legally organized is a full-service, boutique concierge firm that provides errand and personal assistant-type support to legal professionals in the los angeles area.
Red Butler | Personal Assistant & Concierge Services | 888.BUTLER.2


Red Butler provides luxurious and affordable concierge services & personal assistant services for individual use, or for large scale corporate concierge accounts.
corporate and personal concierge services in sacramento, ca


city concierge provides lifestyle management solutions to individuals, companies and properties in the greater sacramento area. ⠀
marcstone property concierge services for southwest colorado


marcstone provides property concierge services for second homes as well as vacant home services for sellers and builders
concierge orlando - your personal concierge for orlando conventions - home


experienced local concierges and hospitality experts offer complimentary assistance with selecting orlando dining, party planning and business entertaining.

Update graph to the last: 7 days | 1 month | 3 months | 6 months
Compare myudr.com to:


Worldwide Traffic Rank
Country Rank
United States:

Websites Hosted On Same Network Analysis
Domain Daily traffic Daily earnings Rank Ip Adress
n/a colorroomsalon.com ≈66$0.8316,815,707173.201.164.104
n/a westorangeparade.com ≈126$1.248,650,831173.201.164.107
n/a theoryoflivevolution.com ≈300$2.023,914,143173.201.164.107
n/a mocwebdesign.com ≈52$0.7418,782,966173.201.164.107
n/a sinoaid.cn ≈134$1.38,129,761173.201.164.11
n/a dealzbydesign.com ≈904$4.031,012,733173.201.164.110
n/a sadieandharrydavis.org ≈52$0.7424,581,428173.201.164.111
n/a wrap-on.com ≈114$1.219,933,418173.201.164.113
n/a bronxmedicalmalpracticelawyersfirm.com ≈198$1.585,945,848173.201.164.120
n/a brooklynmedicalmalpracticelawyersfirm.com ≈214$1.675,344,405173.201.164.121

Websites with similar rank Analysis
Rank Website Ip adress Primary Country
319,015loginvovchyk.ru217.12.219.140     Russia
319,024lexisnexis.co.uk207.24.42.3     United Kingdom
319,026myudr.com173.201.164.60n/a -
319,028jobnut.co.uk82.113.148.36     United Kingdom
319,029issouk.com89.145.83.139     India
319,034npf.org.tw220.128.175.146     Taiwan

Search Engine Report
Google Page Rank:  
Google Indexed Links: Go to www.google.com and type site:myudr.com
Yahoo Indexed Links: Go to http://siteexplorer.search.yahoo.com and type myudr.com
Google backlinks: Go to www.google.com and type link:myudr.com
Yahoo backlinks: Go to http://siteexplorer.search.yahoo.com and type myudr.com
Dmoz: No
Tags: rent payment online electronic rental payments pay my rent renew my lease utility connection call maintenance superintendent apartment service concierge
Domain Archive: Go to http://whois.domaintools.com and type your site.

IP & Spy Tools
Nameservers: NS-1435.AWSDNS-51.ORG :
NS-358.AWSDNS-44.COM :
NS-733.AWSDNS-27.NET :
Adsense ID: not found
Analytics ID: not found
Same Adsense Account: not found
Same Analytics Account: not found
Similar Sites:
  *adsense and analytics checked for domain root only, and no subpages.

DNS Records
HostTypeTarget / IPClassTTLOther
myudr.comNS IN3600target: pdns01.domaincontrol.com
myudr.comNS IN3600target: pdns02.domaincontrol.com
www.myudr.comCNAME IN600target: myudr.com
myudr.comSOA IN3600mname: pdns01.domaincontrol.com
rname: dns.jomax.net
serial: 2013050705
refresh: 28800
retry: 7200
expire: 604800
minimum-ttl: 3600
myudr.comMX IN3600pri: 0
target: smtp.secureserver.net
myudr.comMX IN3600pri: 10
target: mailstore1.secureserver.net
myudr.com has address
myudr.com mail is handled by smtp.secureserver.net
myudr.com mail is handled by mailstore1.secureserver.net

Headings - Seo Onpage
Pay Rent, Schedule Service, & More
Other Tools
UDR Toll Free Resident Relations:
Pay Rent
Schedule Maintenance
Renew Lease Online
Connect on the go
UDR Resources
Features & Apps
How to Use

Onpage data links

Internal Links

Tell us what you thinkhttp://myudr.com/mailto:areyouhappy@udr.com

External Links

Apartment Searchhttp://www.udr.com/SearchResults.aspx
Modern Livinghttp://www.udr.com/ModernLiving.aspx
Investor Relationshttp://www.snl.com/irweblinkx/corporateprofile.aspx?iid=103025&xslt=103025_dev1
Connect Utilities Onlinehttp://udrconnect.whitefence.com/
Sign up for Gmailhttp://mail.google.com/mail
Sign up for Yahoo! Mailhttps://login.yahoo.com/config/login_verify2
Green Livinghttp://www.udr.com/GreenLiving.aspx
Investor Relationshttp://www.snl.com/irweblinkx/corporateprofile.aspx?iid=103025
Site Maphttp://www.udr.com/Sitemap.aspx
Privacy Policyhttp://www.udr.com/Privacy-Policy.aspx
iPhone Apphttp://itunes.apple.com/us/app/apartments-by-udr-inc/id340554549?mt=8
MyUDR (Residents)https://property.onesite.realpage.com/templates/template_udrt_thirty377_res_a...
Room Painterhttp://www.udr.com/Room-Painter
Furniture Arrangerhttp://www.udr.com/Furniture-Arranger.aspx
Google Mapshttp://www.udr.com/How-To-Use-Google-Maps.aspx
Contact Ushttp://www.udr.com/Contact-Us.aspx
Office Locationshttp://www.udr.com/Office-Locations.aspx

Backlinks Scheme

Backlinks Graphic

Avg AntivirusSafe
Wot RaitingGood
SiteAdvisorNot yet rated
Child SafetyExcellent

Search Volume Index

Whois Report
Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

   Domain Name: MYUDR.COM
   Registrar: GODADDY.COM, LLC

Time Elapsed: 0.04281 sec